PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G053400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 355aa    MW: 37123.6 Da    PI: 7.3633
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G053400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-32162215255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Seita.6G053400.1.p 162 PRMRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 215
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-29159216IPR009057Homeodomain-like
SuperFamilySSF466898.96E-16160216IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-24162215IPR006447Myb domain, plants
PfamPF002495.8E-7163214IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELFPSQPDL SLQIGLPTSA TPHDHHHHAA AAALNARFFA AAGGGGNGVG NPAAMAPSLQ  60
LPMPVPLPLP VQLPMPPSAA AGAAGLYYHP DASMLRPIRG VPLYQHPHTH AVPPTFPPHA  120
AAAGPCFCEP CHVAAGAWRR AGCGAGARVA GFPPAKRAAR APRMRWTSTL HARFVHAVEL  180
LGGHDRATPK SVLELMDVKD LTLAHVKSHL QMYRTVKNTE RPAASSDQAD GFENGSAGEI  240
CDDNSLDLHG YGGGGSGRPE SAAAAARHGR LAACNDHGSS TGAHGALWNS SSREDWTGFP  300
SESNTGSMHS LKEQMQSKSL EILSDMNSCV SETTSSTSEL NLEFTLGRPQ NRPN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570080.0EU957008.1 Zea mays clone 1580405 KANADI-like transcription factor FEATHERED mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972778.10.0PREDICTED: probable transcription factor RL9 isoform X1
SwissprotQ0J2351e-43ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLB6SW931e-172B6SW93_MAIZE; KANADI-like transcription factor FEATHERED
STRINGGRMZM2G123308_P021e-171(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47213665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-36G2-like family protein